The CLH domain within your query sequence starts at position 1278 and ends at position 1424, and its E-value is 1.59e-48.

LHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTELAILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMNHPTDAWKEGQFKDIITKVANVELYYKAIQFYLEFKPLLLN
CLH

CLH

Clathrin heavy chain repeat homology
SMART ACC:SM000299
Description: -
InterPro ACC:IPR000547
InterPro abstract:

Clathrin is a triskelion-shaped cytoplasmic protein that polymerises into a polyhedral lattice on intracellular membranes to form protein-coated membrane vesicles. Lattice formation induces the sorting of membrane proteins during endocytosis and organelle biogenesis by interacting with membrane-associated adaptor molecules. Clathrin functions as a trimer, and these trimers, or triskelions, are … expand

GO process:vesicle-mediated transport (GO:0016192), intracellular protein transport (GO:0006886)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 15 795 CLH domains in 3 386 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CLH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CLH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CLH domain which could be assigned to a KEGG orthologous group, and not all proteins containing CLH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamClathrin_repeat
InterProIPR000547