The BHD_2 domain within your query sequence starts at position 677 and ends at position 737, and its E-value is 4.96e-24.

LHSRDTWLKQARVVRLGEVPYKMVKGFSNRARKARLSEPQLHDHNDLGLYGHWQTEEYQPP
BHD_2

BHD_2

Rad4 beta-hairpin domain 2
SMART ACC:SM001031
Description:This short domain is found in the Rad4 protein. This domain binds to DNA.
InterPro ACC:IPR018327
InterPro abstract:

This short domain is found in the Rad4 protein. This domain binds to DNA [ PUBMED:17882165 ].

GO function:DNA binding (GO:0003677)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 099 BHD_2 domains in 2 095 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BHD_2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BHD_2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport

Relevant references for this domain

Primary literature for the BHD_2 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BHD_2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing BHD_2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamBHD_2
InterProIPR018327