The CYTH domain within your query sequence starts at position 5 and ends at position 200, and its E-value is 1.29e-13.

LIEVERKFAPGPDTEERLQELGATLEHRVTFRDTYYDTSELSLMLSDHWLRQREGSGWELKCPGVTGVSGPHNEYVEVTSEAAIVAQLFELLGSGEQKPAGVAAVLGSLKLQEVASFITTRSSWKLALSGAHGQEPQLTIDLDSADFGYAVGEVEAMVHEKAEVPAALEKIITVSSMLGVPAQEEAPAKLMVYLQR
CYTH

CYTH

SMART ACC:SM001118
Description:These sequences are functionally identified as members of the adenylate cyclase family, which catalyses the conversion of ATP to 3',5'-cyclic AMP and pyrophosphate. Six distinct non-homologous classes of AC have been identified. The structure of three classes of adenylyl cyclases have been solved ((PUBMED:16905149)).
InterPro ACC:IPR023577
InterPro abstract:

The entry represents the CYTH domain. The bacterial CyaB like adenylyl cyclase and the mammalian thiamine triphosphatases (ThTPases) define a superfamily of catalytic domains called the CYTH (CyaB, thiamine triphosphatase) domain that is present in all three superkingdoms of life [ PUBMED:22984449 ]. Proteins containing … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 17 696 CYTH domains in 17 691 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CYTH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CYTH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the CYTH domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CYTH domain which could be assigned to a KEGG orthologous group, and not all proteins containing CYTH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR023577
PfamCYTH