The Brix domain within your query sequence starts at position 22 and ends at position 147, and its E-value is 5.12e-17.

LIFSSRGINFRTRHLMQDLRMLMPHSKADTKMDRKDKLFVINEVCEMKNCNKCIYFEAKKKQDLYMWLSNSPHGPSAKFLVQNIHTLAELKMTGNCLKGSRPLLSFDPAFDDLPHYALLKEFLIQI
Brix

Brix

SMART ACC:SM000879
Description:The Brix domain is found in a number of eukaryotic proteins including SSF proteins from yeast and humans, Arabidopsis thaliana Peter Pan-like protein and several hypothetical proteins.
InterPro ACC:IPR007109
InterPro abstract:

Analysis of the Brix (biogenesis of ribosomes in Xenopus) protein leaded to the identification of a region of 150-180 residues length, called the Brixdomain, which is found in six protein families: one archaean family (I) including hypothetical proteins (one per genome); and five eukaryote families, each named according to a representative member and including close homologues of this prototype: … expand

GO process:rRNA processing (GO:0006364)
GO function:rRNA binding (GO:0019843)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 8 454 Brix domains in 8 450 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Brix domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Brix domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

Relevant references for this domain

Primary literature for the Brix domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Brix domain which could be assigned to a KEGG orthologous group, and not all proteins containing Brix domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR007109
PfamBrix