The PI3Kc domain within your query sequence starts at position and ends at position , and its E-value is < 1e-12.

LINVLRECCETIKRLKDTTAKKMELLVHLLETKVRPLVKVRPIALPLDPDVLICDVCPETSKVFKSSLSPLKITFKTTLNQPY
PI3Kc

PI3Kc

Phosphoinositide 3-kinase, catalytic domain
SMART ACC:SM000146
Description:Phosphoinositide 3-kinase isoforms participate in a variety of processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, and apoptosis. These homologues may be either lipid kinases and/or protein kinases: the former phosphorylate the 3-position in the inositol ring of inositol phospholipids. The ataxia telangiectesia-mutated gene produced, the targets of rapamycin (TOR) and the DNA-dependent kinase have not been found to possess lipid kinase activity. Some of this family possess PI-4 kinase activities.
InterPro ACC:IPR000403
InterPro abstract:

This entry represents the catalytic domain of PI3 and PI-4 kinases. This domain is also found in a number of pseudokinases, where a lack of typical motifs at the catalytic site suggest a lack of kinase activity.

Phosphatidylinositol 3-kinase (PI3-kinase) ( EC:2.7.1.137 ) [ PUBMED:1322797 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 18 030 PI3Kc domains in 18 022 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PI3Kc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PI3Kc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Phosphoinositide-phosphorylation

Relevant references for this domain

Primary literature for the PI3Kc domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the PI3Kc domain.

ProteinDescriptionDisease / phenotype
ATM_HUMANOMIM:208900 : Ataxia-telangiectasia ; T-cell prolymphocytic leukemia, sporadic ; Lymphoma, B-cell non-Hodgkin, somatic ; {Breast cancer, susceptibility to} ; Lymphoma, mantle cell

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PI3Kc domain which could be assigned to a KEGG orthologous group, and not all proteins containing PI3Kc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamPI3_PI4_kinase
InterProIPR000403