The APC10 domain within your query sequence starts at position 3810 and ends at position 3968, and its E-value is 1.11e-18.

LKDLTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITINCVKGINARYVSVHVDNSRDLGNKVTSMTFLTGKAVEELCRIKQVDLDSRHIGWVTSELPGGDNQIIKIELKGPENTLRVRQVKVLGWKDGESTKIAGQISASVAQQRSCEAE
APC10

APC10

Anaphase-promoting complex, subunit 10 (APC10)
SMART ACC:SM001337
Description: -
InterPro ACC:IPR004939
InterPro abstract:

The anaphase-promoting complex (APC) or cyclosome is a multi-subunit E3 protein ubiquitin ligase that regulates important events in mitosis, such as the initiation of anaphase and exit from telophase. The APC, in conjunction with other enzymes, assembles multi-ubiquitin chains on a variety of regulatory proteins, thereby targeting them for proteolysis by the 26S proteasome [ expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 716 APC10 domains in 4 712 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing APC10 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing APC10 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the APC10 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a APC10 domain which could be assigned to a KEGG orthologous group, and not all proteins containing APC10 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamAPC10
InterProIPR004939