The IG domain within your query sequence starts at position 13991 and ends at position 14070, and its E-value is 1.85e-7.

LKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPNDKVVTRSEGRVHTLTLRDVKLEDAGEVQLTAKDFKTQANLFVK
IG

IG

Immunoglobulin
SMART ACC:SM000409
Description: -
InterPro ACC:IPR003599
InterPro abstract:

This entry represents a subtype of the immunoglobulin domain which is found in a group of proteins that includes:

  • Cell surface receptors containing an immunoglobulin domain.
  • Killer cell inhibitory receptors.
  • Cell adhesion molecules.

The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 417 572 IG domains in 173 507 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IG domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IG domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the IG domain.

ProteinDescriptionDisease / phenotype
MYP0_HUMANOMIM:159440 : Charcot-Marie-Tooth neuropathy-1B
OMIM:118200 : Dejerine-Sottas disease, myelin P-zero-related
OMIM:145900 : Hypomyelination, congenital
FCG2A_HUMANOMIM:146790 : {Lupus nephritis, susceptibility to}
NTRK1_HUMANOMIM:191315 : Insensitivity to pain, congenital, with anhidrosis
OMIM:256800 : Medullary thyroid carcinoma, familial
OMIM:155240 : no description
FGFR2_HUMANOMIM:176943 : Crouzon syndrome
OMIM:123500 : Jackson-Weiss syndrome
OMIM:123150 : Beare-Stevenson cutis gyrata syndrome
OMIM:123790 : Pfeiffer syndrome
OMIM:101600 : Apert syndrome
OMIM:101200 : Saethre-Chotzen syndrome
DCC_HUMANOMIM:120470 : Colorectal cancer
FCG3A_HUMANOMIM:146740 : {Lupus erythematosus, systemic, susceptibility}
OMIM:152700 : Neutropenia, alloimmune neonatal ; {Viral infections, recurrent}
CD4_HUMANOMIM:186940 : {Lupus erythematosus, susceptibility to}
ICAM1_HUMANOMIM:147840 : {Malaria, cerebral, susceptibility to}
MYPC3_HUMANOMIM:600958 : Cardiomyopathy, familial hypertrophic, 4
OMIM:115197 : no description
L1CAM_HUMANOMIM:308840 : Hydrocephalus due to aqueductal stenosis
OMIM:307000 : MASA syndrome
OMIM:303350 : Spastic paraplegia
OMIM:312900 : no description
PVR_HUMANOMIM:173850 : {Polio, susceptibility to}

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IG domain which could be assigned to a KEGG orthologous group, and not all proteins containing IG domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamig
InterProIPR003599