The Nbs1_C domain within your query sequence starts at position 680 and ends at position 744, and its E-value is 2.14e-34.

LKNFKKFKKATFPGAGKLPHIIGGSDLVGHHARKNTELEEWLKQEMEVQKQQAKEESLADDLFRY
Nbs1_C

Nbs1_C

DNA damage repair protein Nbs1
SMART ACC:SM001348
Description:This C terminal region of the DNA damage repair protein Nbs1 has been identified to be necessary for the binding of Mre11 and Tel1 (PMID:15964794).
InterPro ACC:IPR013908
InterPro abstract:

This is the C-terminal region of Nibrin (also known as DNA damage repair protein Nbs1) that has been identified to be necessary for the binding of Mre11 and Tel1 [ PUBMED:15964794 ].

Nibrin (also known as Nbs1 or p95) plays an important role in the DNA damage response (DDR) and DNA repair. It is part of the … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 355 Nbs1_C domains in 354 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Nbs1_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Nbs1_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Replication

Relevant references for this domain

Primary literature for the Nbs1_C domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Nbs1_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing Nbs1_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR013908
PfamNbs1_C