The zf-3CxxC domain within your query sequence starts at position 195 and ends at position 280, and its E-value is 3.38e-23.

LKYGYFHCKDCKRRWESAYVWCISGTNKVYFKQLCNKCQKSFNPYRVEEIQCQTCLRVCCSCSPKKRHIDVRRPHRQELCGHCKDK
zf-3CxxC

zf-3CxxC

Zinc-binding domain
SMART ACC:SM001328
Description:This is a family with several pairs of CxxC motifs possibly representing a multiple zinc-binding region. Only one pair of cysteines is associated with a highly conserved histidine residue.
InterPro ACC:IPR027377
InterPro abstract:

This is a domain with several pairs of CxxC motifs, referred to as 3CxxC-type zinc finger which is found in 3CxxC-type zinc finger proteins, such as zygote arrest protein 1 (ZAR1) and its homologues, ZAR1-like proteins, and receptor-transporting proteins 1-5 (RTP1-5). Only one pair of cysteines is associated with a highly conserved histidine residue.

ZAR1 is essential for female fertility … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 480 zf-3CxxC domains in 2 474 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing zf-3CxxC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing zf-3CxxC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a zf-3CxxC domain which could be assigned to a KEGG orthologous group, and not all proteins containing zf-3CxxC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR027377
Pfamzf-3CxxC