The DUF4210 domain within your query sequence starts at position 348 and ends at position 406, and its E-value is 9.25e-30.

LLGNFEESLLRGRFAPSGHIEGFTAEIGASGSYCPQHVTLPVTVTFFDVSEQNAPAPFL
DUF4210

DUF4210

SMART ACC:SM001177
Description:This short domain is found in fungi, plants and animals, and the proteins appear to be necessary for chromosome segregation during meiosis.
InterPro ACC:IPR025261
InterPro abstract:

This domain is found in the central region of Drosophila Atos, its homologues from mammals, Atos homologue protein A/B (ATOSA/B, formerly known as FAM241) and S.pombe C3H8.04 (SPACC3H8.04), the orthologue of human ATOSA which, from a high-throughput knockout screening, was identified as a protein required for meiotic chromosome segregation [ PUBMED:16169489 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 631 DUF4210 domains in 1 630 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF4210 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF4210 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the DUF4210 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF4210 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF4210 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR025261
PfamDUF4210