The FYRN domain within your query sequence starts at position 1402 and ends at position 1445, and its E-value is 1.18e-21.

LLPQQMQAFHSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEE
FYRN

FYRN

"FY-rich" domain, N-terminal region
SMART ACC:SM000541
Description:is sometimes closely juxtaposed with the C-terminal region (FYRC), but sometimes is far distant. Unknown function, but occurs frequently in chromatin-associated proteins.
InterPro ACC:IPR003888
InterPro abstract:

The "FY-rich" domain N-terminal (FYRN) and "FY-rich" domain C-terminal (FYRC) sequence motifs are two poorly characterised phenylalanine/ tyrosine-rich regions of around 50 and 100 amino acids, respectively, that are found in a variety of chromatin-associated proteins [ PUBMED:9247308 expand

GO component:nucleus (GO:0005634)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 181 FYRN domains in 3 175 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FYRN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FYRN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport

Relevant references for this domain

Primary literature for the FYRN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FYRN domain which could be assigned to a KEGG orthologous group, and not all proteins containing FYRN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003888