The Kelch domain within your query sequence starts at position 515 and ends at position 564, and its E-value is 2.7e0.

LLYVTGGRWQGMDGDYHVEMEAYDTVRDAWARHGSLPRLWLYHGASTIFL
Kelch

Kelch

SMART ACC:SM000612
Description: -
InterPro ACC:IPR006652
InterPro abstract:

This entry represents a type of kelch sequence motif that comprises one β-sheet blade.

Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [ PUBMED:8453663 ]. This sequence motif represents one β-sheet blade, and several of these repeats can associate to form a β-propeller. … expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 151 337 Kelch domains in 35 376 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Kelch domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Kelch domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Kelch domain which could be assigned to a KEGG orthologous group, and not all proteins containing Kelch domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006652
PfamKelch motif