The DnaJ domain within your query sequence starts at position 60 and ends at position 117, and its E-value is 5.73e-23.

LNFYEFLGVQQDASSADIRKAYRKLSLTLHPDKNKDENAETQFRQLVAIYEVLKDDER
DnaJ

DnaJ

DnaJ molecular chaperone homology domain
SMART ACC:SM000271
Description: -
InterPro ACC:IPR001623
InterPro abstract:
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 142 417 DnaJ domains in 142 230 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DnaJ domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DnaJ domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DnaJ domain which could be assigned to a KEGG orthologous group, and not all proteins containing DnaJ domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEDNAJ_CXXCXGXG
InterProIPR001623
PfamDnaJ_CXXCXGXG