The Ribosomal_L2_C domain within your query sequence starts at position 96 and ends at position 231, and its E-value is 6.56e-67.

LNIGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHNPETKKTRVKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPA
Ribosomal_L2_C

Ribosomal_L2_C

Ribosomal Proteins L2, C-terminal domain
SMART ACC:SM001382
Description: -
InterPro ACC:IPR022669
InterPro abstract:
This entry represents the C-terminal domain of the large ribosomal subunit protein uL2.

Ribosomal protein uL2 is one of the proteins from the large ribosomal subunit. The best conserved region is located in the C-terminal section of these proteins. In Escherichia coli, uL2 is known to bind to the 23S rRNA and to have peptidyltransferase activity. It belongs to a family of ribosomal proteins which … expand

GO process:translation (GO:0006412)
GO component:ribosome (GO:0005840)
GO function:structural constituent of ribosome (GO:0003735)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 22 837 Ribosomal_L2_C domains in 22 831 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Ribosomal_L2_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Ribosomal_L2_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Ribosomal_L2_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing Ribosomal_L2_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR022669
PfamRibosomal_L2_C