The PIPKc domain within your query sequence starts at position 72 and ends at position 420, and its E-value is 2.3e-172.

LPDDFKASSKIKVNNHFFHRENLPSHFKFKEYCPQVFRNLRDRFAIDDHDYLVSLTRSPPSETEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVENEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTLKDMDFLNKNQKVYIGEEEKKVFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEGPVREEESEWDGDCNLAGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFIANIF
PIPKc

PIPKc

Phosphatidylinositol phosphate kinases
SMART ACC:SM000330
Description: -
InterPro ACC:IPR002498
InterPro abstract:

This entry represents a conserved region from the common kinase core found in the type I phosphatidylinositol-4-phosphate 4 and 5-kinases (PIP4K/PIP5K) family as described in [ PUBMED:9535851 ]. This region is found in I, II and III phosphatidylinositol-4-phosphate 5-kinases (PIP5K enzymes). PIP5K catalyses the formation … expand

GO process:phosphatidylinositol metabolic process (GO:0046488)
GO function:phosphatidylinositol kinase activity (GO:0052742)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 642 PIPKc domains in 3 635 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PIPKc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PIPKc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the PIPKc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PIPKc domain which could be assigned to a KEGG orthologous group, and not all proteins containing PIPKc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002498