The PUR domain within your query sequence starts at position 231 and ends at position 292, and its E-value is 6.56e-23.

LPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEMK
PUR

PUR

DNA/RNA-binding repeats in PUR-alpha/beta/gamma and in hypothetical proteins from spirochetes and the Bacteroides-Cytophaga-Flexibacter bacteria.
SMART ACC:SM000712
Description: -
InterPro ACC:IPR006628
InterPro abstract:

The purine-rich element binding (Pur) protein family protein consists of DNA-binding proteins from animals, plants and bacteria, including PURalpha/beta/gamma from humans, Pur-alpha 1 from Arabidopsis thaliana and Transcriptional/translational repressor BpuR from Borreliella burgdorferi. Human Pur-alpha is a highly conserved, sequence-specific DNA-and RNA-binding protein involved in diverse cellular … expand

GO function:RNA polymerase II transcription regulatory region sequence-specific DNA binding (GO:0000977), purine-rich negative regulatory element binding (GO:0032422)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 151 PUR domains in 1 448 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PUR domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PUR domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:DNA/RNA-binding

Relevant references for this domain

Primary literature for the PUR domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PUR domain which could be assigned to a KEGG orthologous group, and not all proteins containing PUR domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006628