The ADSL_C domain within your query sequence starts at position 362 and ends at position 446, and its E-value is 5.65e-28.

LPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAAAVVKQEGGDNDLIERIRADAYFSPIHSQLEHLLDPSSFTGRAPQQVHRFL
ADSL_C

ADSL_C

Adenylosuccinate lyase C-terminus
SMART ACC:SM000998
Description:Adenylosuccinate lyase catalyses two steps in the synthesis of purine nucleotides: the conversion of succinylaminoimidazole-carboxamide ribotide into aminoimidazole-carboxamide ribotide (the fifth step of de novo IMP biosynthesis); the formation of adenosine monophosphate (AMP) from adenylosuccinate (the final step in the synthesis of AMP from IMP). This entry represents the C-terminal, seven alpha-helical, domain of adenylosuccinate lyase.
InterPro ACC:IPR019468
InterPro abstract:

Adenylosuccinate lyase catalyses two steps in the synthesis of purine nucleotides: the conversion of succinylaminoimidazole-carboxamide ribotide into aminoimidazole-carboxamide ribotide (the fifth step of de novo IMP biosynthesis); the formation of adenosine monophosphate (AMP) from adenylosuccinate (the final step in the synthesis of AMP from IMP) [ PUBMED:17485188 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 18 432 ADSL_C domains in 18 430 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ADSL_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ADSL_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the ADSL_C domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ADSL_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing ADSL_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR019468
PfamADSL_C