The FBOX domain within your query sequence starts at position 45 and ends at position 85, and its E-value is 4.77e-11.

LPHHVILQIFQYLPLIDRARASSVCRRWNEVFHIPDLWRKF
FBOX

FBOX

A Receptor for Ubiquitination Targets
SMART ACC:SM000256
Description: -
InterPro ACC:IPR001810
InterPro abstract:

First identified in cyclin-F as a protein-protein interaction motif, the F-box is a conserved domain that is present in numerous proteins with a bipartite structure [ PUBMED:8706131 ]. Through the F-box, these proteins are linked to the Skp1 protein and the core of SCFs (Skp1-cullin-F-box protein ligase) complexes. SCFs … expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 84 937 FBOX domains in 82 912 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FBOX domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FBOX domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the FBOX domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FBOX domain which could be assigned to a KEGG orthologous group, and not all proteins containing FBOX domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001810
PfamF-box