The IPT domain within your query sequence starts at position 1657 and ends at position 1743, and its E-value is 1.89e-5.

LPNIDMVMPKAGSTTGMTRVTIQGSGFMSSPEGVEVFMGDFPCKVLSVTYTAIECETSPAPQQLVLVDILIHGVPAQCQSNCSFSYL
IPT

IPT

ig-like, plexins, transcription factors
SMART ACC:SM000429
Description: -
InterPro ACC:IPR002909
InterPro abstract:

The IPT (Ig-like, plexins, transcription factors) domain has an immunoglobulin like fold [ PUBMED:10390613 ]. These domains are found in cell surface receptors such as Met and Ron as well as in intracellular transcription factors where it is involved in DNA binding. The Ron tyrosine kinase receptor shares with the members … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 37 987 IPT domains in 14 790 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IPT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IPT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the IPT domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IPT domain which could be assigned to a KEGG orthologous group, and not all proteins containing IPT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002909