The CG-1 domain within your query sequence starts at position 34 and ends at position 155, and its E-value is 1.07e-83.

LPPERLRWNTNEEIASYLITFEKHDEWLSCAPKTRPQNGSIILYNRKKVKYRKDGYLWKKRKDGKTTREDHMKLKVQGMEPVSWQCLYGCYVHSSIVPTFHRRCYWLLQNPDIVLVHYLNVP
CG-1

CG-1

SMART ACC:SM001076
Description:CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein (PUBMED:8075408). CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin -binding domain and ankyrins (ANK) motifs (PUBMED:11925432).
InterPro ACC:IPR005559
InterPro abstract:

CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite nuclear localisation signal. They are named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein [ PUBMED:8075408 ]. CG-1 domains are found in CAMTA proteins (for CAlModulin … expand

GO function:DNA binding (GO:0003677)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 235 CG-1 domains in 2 230 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CG-1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CG-1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the CG-1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CG-1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing CG-1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

PfamCG-1
InterProIPR005559