The Gal-bind_lectin domain within your query sequence starts at position 181 and ends at position 301, and its E-value is 3.6e-12.

LPRGLWPGQVIVVRGLVLKEPKDFTLSLKDGTTHVPVTLRASFTDRTLAWVSSWGRKKLISAPFLFHPQRFFEVLLLCQEGGLKLALNGQGLGATSLDQKALEQLRELRISGNVHLYCVHC
Gal-bind_lectin

Gal-bind_lectin

Galactoside-binding lectin
SMART ACC:SM000908
Description:Animal lectins display a wide variety of architectures. They are classified according to the carbohydrate-recognition domain (CRD) of which there are two main types, S-type and C-type. Galectins (previously S-lectins) bind exclusively beta-galactosides like lactose. They do not require metal ions for activity. Galectins are found predominantly, but not exclusively in mammals (PUBMED:8124704). Their function is unclear. They are developmentally regulated and may be involved in differentiation, cellular regulation and tissue construction.
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 10 779 Gal-bind_lectin domains in 7 909 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Gal-bind_lectin domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Gal-bind_lectin domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Gal-bind_lectin domain which could be assigned to a KEGG orthologous group, and not all proteins containing Gal-bind_lectin domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamGal-bind_lectin