The C2 domain within your query sequence starts at position and ends at position , and its E-value is < 1e-12.

LPSTNFVKLEKLLMNANLSMVSNLIYKSSSSMENDNKLTQTSIIFLDIFQSLSRIEEWFHVLIDKELAKIDG
C2

C2

Protein kinase C conserved region 2 (CalB)
SMART ACC:SM000239
Description:Ca2+-binding motif present in phospholipases, protein kinases C, and synaptotagmins (among others). Some do not appear to contain Ca2+-binding sites. Particular C2s appear to bind phospholipids, inositol polyphosphates, and intracellular proteins. Unusual occurrence in perforin. Synaptotagmin and PLC C2s are permuted in sequence with respect to N- and C-terminal beta strands. SMART detects C2 domains using one or both of two profiles.
InterPro ACC:IPR000008
InterPro abstract:

The C2 domain is a Ca 2+ -dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking. C2 domains are unique among membrane targeting domains in that they show wide range of lipid selectivity for the major components of cell membranes, including phosphatidylserine and phosphatidylcholine. This C2 domain is about 116 amino-acid … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 169 765 C2 domains in 106 000 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing C2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing C2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Calcium-binding, phospholipid-binding, inositol polyphosphate-binding, membrane-binding

Relevant references for this domain

Primary literature for the C2 domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the C2 domain.

ProteinDescriptionDisease / phenotype
PERF_HUMANOMIM:170280 : Hemophagocytic lymphohistiocytosis, familial, 2
OMIM:603553 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a C2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing C2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEC2_DOMAIN_2
InterProIPR000008
PfamC2