The NDK domain within your query sequence starts at position 11 and ends at position 115, and its E-value is 1.9e-28.

Some of the required catalytic sites were not detected in this domain, and are marked red in the sequence below. The domain is probably inactive. Check the literature (PubMed 95399390 ) for details.

Catalytic residues
Position
DomainProteinAmino acidPresent?
N/AN/AHNo
LQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRTRELQWKLEDCRRFYREHEGRFFYQRLVEFMTSGPIRAYILAHKDAIQLWRTLMGPTRVFRARYIAPDSI
NDK

NDK

SMART ACC:SM000562
Description:These are enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates. These enzymes play important roles in bacterial growth, signal transduction and pathogenicity.
InterPro ACC:IPR034907
InterPro abstract:

This entry represents the Nucleoside diphosphate kinase-like domain that contains an α/β fold. It is also found at the C-terminal of retinitis pigmentosa 2 protein (XRP2/RP2) [ PUBMED:16472755 ]. XRP2, a GTPase-activating protein, is required for the maintenance of rod and cone photoreceptor cells in the retina [ expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 22 429 NDK domains in 21 229 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing NDK domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing NDK domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the NDK domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the NDK domain.

ProteinDescriptionDisease / phenotype
NDKA_HUMANOMIM:156490 : Neuroblastoma

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a NDK domain which could be assigned to a KEGG orthologous group, and not all proteins containing NDK domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR034907