The Spt4 domain within your query sequence starts at position 13 and ends at position 73, and its E-value is 7.28e-10.

LRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGRSRLTMNDEAGCVD
Spt4

Spt4

Spt4/RpoE2 zinc finger
SMART ACC:SM001389
Description:This family consists of several eukaryotic transcription elongation Spt4 proteins as well as archaebacterial RpoE2 (PMID:8127719). Three transcription-elongation factors Spt4, Spt5, and Spt6 are conserved among eukaryotes and are essential for transcription via the modulation of chromatin structure. Spt4 and Spt5 are tightly associated in a complex, while the physical association of the Spt4-Spt5 complex with Spt6 is considerably weaker. It has been demonstrated that Spt4, Spt5, and Spt6 play roles in transcription elongation in both yeast and humans including a role in activation by Tat. It is known that Spt4, Spt5, and Spt6 are general transcription-elongation factors, controlling transcription both positively and negatively in important regulatory and developmental roles (PMID:11182892). RpoE2 is one of 13 subunits in the archaeal RNA polymerase. These proteins contain a C4-type zinc finger, and the structure has been solved (PMID:19000817). The structure reveals that Spt4-Spt5 binding is governed by an acid-dipole interaction between Spt5 and Spt4, and the complex binds to and travels along the elongating RNA polymerase. The Spt4-Spt5 complex is likely to be an ancient, core component of the transcription elongation machinery.
InterPro ACC:IPR022800
InterPro abstract:

This entry consists of several eukaryotic transcription elongation Spt4 proteins as well as archaebacterial RpoE2 [ PUBMED:8127719 ]. Three transcription-elongation factors Spt4, Spt5, and Spt6 are conserved among eukaryotes and are essential for transcription via the modulation of chromatin structure. Spt4 and Spt5 are … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 181 Spt4 domains in 2 180 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Spt4 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Spt4 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the Spt4 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Spt4 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Spt4 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR022800
PfamSpt4