The Cdc6_C domain within your query sequence starts at position 757 and ends at position 837, and its E-value is 5.45e-12.

LRAIIAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSRLGSCRLLLVEPSRNDLLLRVRLNVSQNDVLFAL
Cdc6_C

Cdc6_C

CDC6, C terminal
SMART ACC:SM001074
Description:The C terminal domain of CDC6 assumes a winged helix fold, with a five alpha-helical bundle (alpha15-alpha19) structure, backed on one side by three beta strands (beta6-beta8). It has been shown that this domain acts as a DNA-localisation factor, however its exact function is, as yet, unknown. Putative functions include: (1) mediation of protein-protein interactions and (2) regulation of nucleotide binding and hydrolysis. Mutagenesis studies have shown that this domain is essential for appropriate Cdc6 activity (PUBMED:11030343).
InterPro ACC:IPR015163
InterPro abstract:

Cdc6 (also known as Cell division cycle 6 or Cdc18) functions as a regulator at the early stages of DNA replication, by helping to recruit and load the Minichromosome Maintenance Complex (MCM) onto DNA and may have additional roles in the control of mitotic entry. Precise duplication of chromosomal DNA is required for genomic stability during replication. Cdc6 has an essential role in DNA replication … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 082 Cdc6_C domains in 4 082 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Cdc6_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Cdc6_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport

Relevant references for this domain

Primary literature for the Cdc6_C domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Cdc6_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing Cdc6_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR015163
PfamCdc6_C