The HEPN domain within your query sequence starts at position 4454 and ends at position 4570, and its E-value is 9.49e-24.

LRQARANFSAARNDLHKNANEWVCFKCYLSTKLALIAADYAVRGKSDKDVKPTALAQKIEEYSQQLEGLTNDVHTLEAYGVDSLKTRYPDLLPFPQIPNDRFTSEVAMRVMECTACI
HEPN

HEPN

Higher Eukarytoes and Prokaryotes Nucleotide-binding domain
SMART ACC:SM000748
Description: -
InterPro ACC:IPR007842
InterPro abstract:

The HEPN (higher eukaryotes and prokaryotes nucleotide-binding) domain is a region of 110 residues found in the C terminus of sacsin, a chaperonin implicated in an early-onset neurodegenerative disease in human, and in many bacterial and archeabacterial proteins. There are three classes of proteins with HEPN domain:

  • Single-domain HEPN proteins found in many bacteria.
  • Two-domain … expand
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 378 HEPN domains in 2 378 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HEPN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HEPN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HEPN domain which could be assigned to a KEGG orthologous group, and not all proteins containing HEPN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR007842