The THY domain within your query sequence starts at position 41 and ends at position 77, and its E-value is 5.7e-9.

LSEVERFDKSKLKKTITEVKNTLPSKETIEQEKEFVK
THY

THY

Thymosin beta actin-binding motif.
SMART ACC:SM000152
Description: -
InterPro ACC:IPR001152
InterPro abstract:

This entry represents beta-thymosin family. Its members include thymosin beta-4, -10, -15 from humans and their homologues (such as thymosin beta 11/12) from fish.

Thymosin beta-4 (Tbeta) is a small protein that sequesters actin monomers to help maintain the high concentrations of unpolymerised actin in higher eukaryotic cells. Its structure has been resolved [ PUBMED:25313062 expand

GO process:actin filament organization (GO:0007015)
GO function:actin monomer binding (GO:0003785)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 289 THY domains in 910 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing THY domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing THY domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a THY domain which could be assigned to a KEGG orthologous group, and not all proteins containing THY domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001152