The A2M_N_2 domain within your query sequence starts at position 470 and ends at position 609, and its E-value is 2.87e-26.

LSIEPLDPRSPSVGDTFILNLQPVGIPAPTFSHYYYMIISRGQIMAMGREPRKTVTSVSVLVDHQLAPSFYFVAYFYHQGHPVANSLLINIQSRDCEGKLQLKVDGAKEYRNADMMKLRIQTDSKALVALGAVDMALYAV
A2M_N_2

A2M_N_2

Alpha-2-Macroglobulin
SMART ACC:SM001359
Description:This family includes a region of the alpha-2-macroglobulin family.
InterPro ACC:IPR011625
InterPro abstract:

Alpha-2-macroglobulins (A2Ms) are plasma proteins that trap and inhibit a broad range of proteases and are major components of the eukaryotic innate immune system [ PUBMED:34970276 ]. However, A2M-like proteins were identified in pathogenic invasive bacteria and species that colonize higher eukaryotes. In human A2Ms … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 13 783 A2M_N_2 domains in 13 732 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing A2M_N_2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing A2M_N_2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a A2M_N_2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing A2M_N_2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR011625
PfamA2M_N_2