The PWI domain within your query sequence starts at position 3 and ends at position 76, and its E-value is 5.99e-29.

LSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAVEEGRSS
PWI

PWI

PWI, domain in splicing factors
SMART ACC:SM000311
Description: -
InterPro ACC:IPR002483
InterPro abstract:

The PWI domain, named after a highly conserved PWI tri-peptide located within its N-terminal region, is a ~80 amino acid module, which is found either at the N terminus or at the C terminus of eukaryotic proteins involved in pre-mRNA processing [ PUBMED:10322432 ]. It is generally found in association with other domains … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 809 PWI domains in 1 807 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PWI domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PWI domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PWI domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PWI domain which could be assigned to a KEGG orthologous group, and not all proteins containing PWI domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002483