The ASCH domain within your query sequence starts at position 437 and ends at position 535, and its E-value is 3.19e-4.

LSMHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATGKRPSPQEVSELQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFQEQGNWIPRSIKE
ASCH

ASCH

SMART ACC:SM001022
Description:The ASCH domain adopts a beta-barrel fold similar to that of the PUA domain. It is thought to function as an RNA-binding domain during coactivation, RNA-processing and possibly during prokaryotic translation regulation (PUBMED:16322048).
InterPro ACC:IPR007374
InterPro abstract:

The ASCH domain adopts a β-barrel fold similar to that of the PUA domain ( IPR002478 ). It is thought to function as an RNA-binding domain during coactivation, RNA-processing and possibly during prokaryotic translation regulation [ PUBMED:16322048 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 10 302 ASCH domains in 10 301 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ASCH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ASCH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation
Binding / catalysis:RNA

Relevant references for this domain

Primary literature for the ASCH domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ASCH domain which could be assigned to a KEGG orthologous group, and not all proteins containing ASCH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR007374
PfamASCH