The ZnF_CDGSH domain within your query sequence starts at position 89 and ends at position 126, and its E-value is 5.55e-5.

LSPLKFKAQETRTVALCTCKATQRPPYCDGTHKSEQVQ
ZnF_CDGSH

ZnF_CDGSH

CDGSH-type zinc finger. Function unknown.
SMART ACC:SM000704
Description: -
InterPro ACC:IPR018967
InterPro abstract:

This entry represents iron-sulphur domain containing proteins that have a CDGSH sequence motif (although the Ser residue can also be an Ala or Thr), and is found in proteins from a wide range of organisms with the exception of fungi. The CDGSH-type domain binds a redox-active pH-labile 2Fe-2S cluster. The conserved sequence C-X-C-X2-(S/T)-X3-P-X-C-D-G-(S/A/T)-H is a defining feature of this family … expand

GO component:intracellular membrane-bounded organelle (GO:0043231)
GO function:2 iron, 2 sulfur cluster binding (GO:0051537)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 690 ZnF_CDGSH domains in 3 268 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ZnF_CDGSH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ZnF_CDGSH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ZnF_CDGSH domain which could be assigned to a KEGG orthologous group, and not all proteins containing ZnF_CDGSH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR018967