The SFM domain within your query sequence starts at position 79 and ends at position 129, and its E-value is 3.33e-24.

LSRQEVIRRLRERGEPIRLFGETDYDAFQRLRKIEILTPEVNKGLRNDLKA
SFM

SFM

Splicing Factor Motif, present in Prp18 and Pr04
SMART ACC:SM000500
Description: -
InterPro ACC:IPR014906
InterPro abstract:

This small domain is found on PRP4 ribonuleoproteins. PRP4 is a U4/U6 small nuclear ribonucleoprotein that is involved in pre-mRNA processing [ PUBMED:528687 ]. It is also found in pre-mRNA-splicing factor 18 [ PUBMED:9000057 ].

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 137 SFM domains in 1 133 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SFM domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SFM domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SFM domain which could be assigned to a KEGG orthologous group, and not all proteins containing SFM domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR014906