The BROMO domain within your query sequence starts at position 2852 and ends at position 2960, and its E-value is 5.5e-37.

LTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERIQKRYYEKLTEFVADMTKIFDNCRYYNPRDTPFYQCAEVLESFFVQKLKGFKA
BROMO

BROMO

bromo domain
SMART ACC:SM000297
Description: -
InterPro ACC:IPR001487
InterPro abstract:

Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [ PUBMED:1350857 ]. Bromodomains are highly conserved α-helical motifs that can specifically interact with acetylated lysine residues on histone tails [ PUBMED:9175470 expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 52 668 BROMO domains in 38 864 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BROMO domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BROMO domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the BROMO domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BROMO domain which could be assigned to a KEGG orthologous group, and not all proteins containing BROMO domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfambromodomain
InterProIPR001487
PROSITEBROMODOMAIN_2