The Robl_LC7 domain within your query sequence starts at position 7 and ends at position 95, and its E-value is 2.65e-10.

LTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDSLKFILMDCMEGRVAITRVANLLLCMYA
Robl_LC7

Robl_LC7

Roadblock/LC7 domain
SMART ACC:SM000960
Description:This family includes proteins that are about 100 amino acids long and have been shown to be related (PUBMED:11084347). Members of this family of proteins are associated with both flagellar outer arm dynein and Drosophila and rat brain cytoplasmic dynein. It is proposed that roadblock/LC7 family members may modulate specific dynein functions (PUBMED:10402468). This family also includes Golgi-associated MP1 adapter protein and MglB from Myxococcus xanthus, a protein involved in gliding motility (PUBMED:2464581). However the family also includes members from non-motile bacteria such as Streptomyces coelicolor, suggesting that the protein may play a structural or regulatory role.
InterPro ACC:IPR004942
InterPro abstract:

This domain can be found in the roadblock proteins and LAMTOR2 proteins.

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 13 442 Robl_LC7 domains in 13 380 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Robl_LC7 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Robl_LC7 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Robl_LC7 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Robl_LC7 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Robl_LC7 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR004942
PfamRobl_LC7