The Gln-synt_C domain within your query sequence starts at position 235 and ends at position 481, and its E-value is 1.67e-39.

LTSPRYIAKRQLRQLQDAGFCLLSAFIYDFCIFGVPEVINSKTISFPASTLLSNHDQPFMQELVEGLYQTGANVESFSSSTRPGQMEICFLPEFGISSADNAFTLRTGLQEVARRYNYIASLVIETGFCNSGILSHSIWDVGGKTNMFCSGSGVERLTLTGKKWLAGLLKHSAALSCLMAPAVNCRKRYCKDSRDLKDSVPTTWGYNDNSCALNIKCHGEKGTQIENKLGSATANPYLVLAATVAAG
Gln-synt_C

Gln-synt_C

Glutamine synthetase, catalytic domain
SMART ACC:SM001230
Description: -
InterPro ACC:IPR008146
InterPro abstract:

This entry represents the C-terminal catalytic domain of GS enzymes.

Glutamine synthetase ( EC:6.3.1.2 ) (GS) [ PUBMED:2900091 ] plays an essential role in the metabolism of nitrogen by catalysing the condensation of glutamate and ammonia to form … expand

GO function:glutamine synthetase activity (GO:0004356)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 49 158 Gln-synt_C domains in 49 148 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Gln-synt_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Gln-synt_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Gln-synt_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing Gln-synt_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR008146
PfamGln-synt_C