The LamB domain within your query sequence starts at position 570 and ends at position 702, and its E-value is 2.09e-57.

LTSTYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETVDSDLMSHADIIIKGNGLTISTRAEGLSLQPYEEYFNVVRLVPENFRDFDTRREIDRDQLMTVLANVTHLLIRANYNSAKMALYRLDSVSLDIASP
LamB

LamB

Laminin B domain
SMART ACC:SM000281
Description: -
InterPro ACC:IPR000034
InterPro abstract:

Laminin is a large molecular weight glycoprotein present only in basement membranes in almost every animal tissue. Each laminin is a heterotrimer assembled from alpha, beta and gamma chain subunits, secreted and incorporated into cell-associated extracellular matrices. The laminins can self-assemble, bind to other matrix macromolecules, and have unique and shared cell interactions mediated by … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 645 LamB domains in 4 077 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LamB domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LamB domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the LamB domain.

ProteinDescriptionDisease / phenotype
LAMA2_HUMANOMIM:156225 : Muscular dystrophy, congenital merosin-deficient

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LamB domain which could be assigned to a KEGG orthologous group, and not all proteins containing LamB domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamlaminin_B
InterProIPR000034