The CTNS domain within your query sequence starts at position 54 and ends at position 85, and its E-value is 1.69e-6.

LVKLPQVFKLLGAKSAEGLSLQSVMLELVALT
CTNS

CTNS

Repeated motif present between transmembrane helices in cystinosin, yeast ERS1p, mannose-P-dolichol utilization defect 1, and other hypothetical proteins.
SMART ACC:SM000679
Description:Function unknown, but likely to be associated with the glycosylation machinery.
InterPro ACC:IPR006603
InterPro abstract:

Some membrane bound proteins possess a pair of repeats each spanning two transmembrane helices connected by a loop [ PUBMED:11731489 ]. The PQ motif found on loop 2 is critical for the localisation of cystinosin to lysosomes [ PUBMED:11150305 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 17 604 CTNS domains in 9 802 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CTNS domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CTNS domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the CTNS domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CTNS domain which could be assigned to a KEGG orthologous group, and not all proteins containing CTNS domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006603