The MAGE domain within your query sequence starts at position 125 and ends at position 295, and its E-value is 2.52e-109.

LVKYLLLKYLMQEPVSKAEILSNIIRNYQDHFAVIFREALECMQLVFGLELKEIDPASHTYILTIALELTYDGMMTDVQGIPKTGLLIMVLSIIFMEGNCVSEDMVWSILNNIGLYAGNEHFIYGEPRKLITDNFVQEGYLEYRHVPGSNPPFYEFLWGPRAYAETTKMKI
MAGE

MAGE

Melanoma-associated antigen
SMART ACC:SM001373
Description:The MAGE (melanoma antigen-encoding gene) family are expressed in a wide variety of tumors but not in normal cells, with the exception of the male germ cells, placenta, and, possibly, cells of the developing embryo. The cellular function of this family is unknown. This family also contains the yeast protein, Nse3. The Nse3 protein is part of the Smc5-6 complex (PMID:15601840, 15331764). Nse3 has been demonstrated to be important for (PMID:15331764).
InterPro ACC:IPR002190
InterPro abstract:

The first mammalian members of the MAGE (melanoma-associated antigen) gene family were originally described as completely silent in normal adult tissues, with the exception of male germ cells and, for some of them, placenta. By contrast, these genes were expressed in various kinds of tumors. However, other members of the family were recently found to be expressed in normal cells, indicating that … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 200 MAGE domains in 5 936 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MAGE domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MAGE domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the MAGE domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MAGE domain which could be assigned to a KEGG orthologous group, and not all proteins containing MAGE domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamMAGE
InterProIPR002190