The B2-adapt-app_C domain within your query sequence starts at position 544 and ends at position 656, and its E-value is 3.75e-42.

LVPNLQLTAEYFEKTWLSLRVSYQQVFPWQGEVQPDTLQMALKVVNIQTIAMSRAGAQPWKAYLSAQDDTGGLFLAELLLKPENSEMQISVKQSKARTESLHGFVSVLETVIG
B2-adapt-app_C

B2-adapt-app_C

Beta2-adaptin appendage, C-terminal sub-domain
SMART ACC:SM001020
Description:Members of this family adopt a structure consisting of a 5 stranded beta-sheet, flanked by one alpha helix on the outer side, and by two alpha helices on the inner side. This domain is required for binding to clathrin, and its subsequent polymerisation. Furthermore, a hydrophobic patch present in the domain also binds to a subset of D-phi-F/W motif-containing proteins that are bound by the alpha-adaptin appendage domain (epsin, AP180, eps15).
InterPro ACC:IPR015151
InterPro abstract:

This entry represents a subdomain of the appendage (ear) domain of beta-adaptin. This domain has a three-layer arrangement, α-β-α, with a bifurcated antiparallel β-sheet [ PUBMED:10430869 ]. This domain is required for binding to clathrin, and its subsequent polymerisation. Furthermore, a hydrophobic patch present in … expand

GO process:intracellular protein transport (GO:0006886), vesicle-mediated transport (GO:0016192)
GO component:clathrin adaptor complex (GO:0030131)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 780 B2-adapt-app_C domains in 1 780 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing B2-adapt-app_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing B2-adapt-app_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a B2-adapt-app_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing B2-adapt-app_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamB2-adapt-app_C
InterProIPR015151