The CPSase_sm_chain domain within your query sequence starts at position 1 and ends at position 139, and its E-value is 8.81e-80.

MAALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIPSDEEDEFGLSKWFESSEIHVAGLVVGECCPTPSHWSANCTLHEWLQQRGIPGLQGVDTRELTKKLREQGSLLGKLV
CPSase_sm_chain

CPSase_sm_chain

Carbamoyl-phosphate synthase small chain, CPSase domain
SMART ACC:SM001097
Description:The carbamoyl-phosphate synthase domain is in the amino terminus of protein. Carbamoyl-phosphate synthase catalyses the ATP-dependent synthesis of carbamyl-phosphate from glutamine or ammonia and bicarbonate. This important enzyme initiates both the urea cycle and the biosynthesis of arginine and/or pyrimidines (PUBMED:1972379). The carbamoyl-phosphate synthase (CPS) enzyme in prokaryotes is a heterodimer of a small and large chain. The small chain promotes the hydrolysis of glutamine to ammonia, which is used by the large chain to synthesise carbamoyl phosphate. The small chain has a GATase domain in the carboxyl terminus.
InterPro ACC:IPR002474
InterPro abstract:

This entry represents the N-terminal domain of the small subunit of carbamoyl phosphate synthase. Structurally, it forms a 3-layer β/β/α fold of a type that is thought to be mobile in most proteins that carry it [ PUBMED:10587438 PUBMED:11729189 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 25 477 CPSase_sm_chain domains in 25 475 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CPSase_sm_chain domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CPSase_sm_chain domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the CPSase_sm_chain domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CPSase_sm_chain domain which could be assigned to a KEGG orthologous group, and not all proteins containing CPSase_sm_chain domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamCPSase_sm_chain
InterProIPR002474