The KISc domain within your query sequence starts at position and ends at position , and its E-value is < 1e-12.

MARSSLPNRRTAQFEANKRRTIAHAPSPSLSNGMHTLTPPTCNNGAATS
KISc

KISc

Kinesin motor, catalytic domain. ATPase.
SMART ACC:SM000129
Description:Microtubule-dependent molecular motors that play important roles in intracellular transport of organelles and in cell division.
InterPro ACC:IPR001752
InterPro abstract:
GO process:microtubule-based movement (GO:0007018)
GO function:microtubule binding (GO:0008017), microtubule motor activity (GO:0003777), ATP binding (GO:0005524)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 50 033 KISc domains in 50 005 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing KISc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing KISc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:ATP-hydrolysis

Relevant references for this domain

Primary literature for the KISc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a KISc domain which could be assigned to a KEGG orthologous group, and not all proteins containing KISc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamkinesin
InterProIPR001752