The CARD domain within your query sequence starts at position 1 and ends at position 90, and its E-value is 3.83e-30.

MDEADRQLLRRCRVRLVSELQVAELWDALLSRELFTRDMIEDIQAGSGSRRDQARQLVTDLETRGRQALPLFISCLEDTGQGTLASLLQS
CARD

CARD

Caspase recruitment domain
SMART ACC:SM000114
Description:Motif contained in proteins involved in apoptotic signalling. Mediates homodimerisation. Structure consists of six antiparallel helices arranged in a topology homologue to the DEATH and the DED domain.
InterPro ACC:IPR001315
InterPro abstract:

The caspase recruitment domain (CARD domain) is a homotypic protein interaction module composed of a bundle of six α-helices. CARD is related in sequence and structure to the death domain (DD, see IPR000488 ) and the death effector domain (DED, see IPR001875 expand

GO process:regulation of apoptotic process (GO:0042981)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 205 CARD domains in 5 027 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CARD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CARD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Protein binding, homodimerization

Relevant references for this domain

Primary literature for the CARD domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CARD domain which could be assigned to a KEGG orthologous group, and not all proteins containing CARD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001315