The DED domain within your query sequence starts at position 21 and ends at position 100, and its E-value is 1.5e-25.

MDFQSCLYAIAEELGSEDLAALKFLCLDYIPHKKQETIEDAQKLFLRLREKGMLEEGNLSFLKELLFHISRWDLLVNFLD
DED

DED

Death effector domain
SMART ACC:SM000031
Description: -
InterPro ACC:IPR001875
InterPro abstract:

The death effector domain (DED) is a homotypic protein interaction module composed of a bundle of six α-helices. DED is related in sequence and structure to the death domain (DD, see IPR000488 ) and the caspase recruitment domain (CARD, see IPR001315 expand

GO process:regulation of apoptotic process (GO:0042981)
GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 001 DED domains in 2 589 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DED domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DED domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the DED domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DED domain which could be assigned to a KEGG orthologous group, and not all proteins containing DED domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001875