The POU domain within your query sequence starts at position 122 and ends at position 196, and its E-value is 3.77e-51.

MDSPEIRELEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAE
POU

POU

Found in Pit-Oct-Unc transcription factors
SMART ACC:SM000352
Description: -
InterPro ACC:IPR000327
InterPro abstract:
This entry represents the POU-specific subunit of the POU domain.The POU domain is a bipartite domain composed of two subunits separated by a non-conserved region of 15-55 aa. The N-terminal subunit is known as the POU-specific (POUs) domain (this entry), while the C-terminal subunit is a homeobox domain ( IPR001356 expand
GO process:regulation of DNA-templated transcription (GO:0006355)
GO function:DNA-binding transcription factor activity (GO:0003700)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 887 POU domains in 6 878 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing POU domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing POU domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Protein-protein interaction

Relevant references for this domain

Primary literature for the POU domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the POU domain.

ProteinDescriptionDisease / phenotype
PIT1_HUMANOMIM:173110 : Pituitary hormone deficiency, combined

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a POU domain which could be assigned to a KEGG orthologous group, and not all proteins containing POU domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEPOU_2
InterProIPR000327
Pfampou