The BASIC domain within your query sequence starts at position 1 and ends at position 86, and its E-value is 7.02e-46.

MELYETSPYFYQEPHFYDGENYLPVHLQGFEPPGYERTELSLSPEARGPLEEKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAA
BASIC

BASIC

Basic domain in HLH proteins of MYOD family
SMART ACC:SM000520
Description: -
InterPro ACC:IPR002546
InterPro abstract:

Members of the bHLH family of transcription factors share homology within a basic domain and an adjacent helix-loop-helix motif. Myogenic factor MyoD belongs to the bHLH family [ PUBMED:8790335 ].

This domain can be found at the N terminus of MyoD, which is muscle specific protein that control muscle development. … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 406 BASIC domains in 1 399 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BASIC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BASIC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the BASIC domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BASIC domain which could be assigned to a KEGG orthologous group, and not all proteins containing BASIC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Links to other resources describing this domain

InterProIPR002546
PfamBasic