The MBD domain within your query sequence starts at position 1 and ends at position 44, and its E-value is 4.8e-6.

MERKSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMNKMNK
MBD

MBD

Methyl-CpG binding domain
SMART ACC:SM000391
Description:Methyl-CpG binding domain, also known as the TAM (TTF-IIP5, ARBP, MeCP1) domain
InterPro ACC:IPR001739
InterPro abstract:

This entry represents the MBD domain. The MBD folds into an α/β-sandwich structure comprising a layer of twisted β-sheet, backed by another layer formed by the α1 helix and a hairpin loop at the C-terminal. These layers are amphipathic, with the α1 helix and the β-sheet lying parallel and the hydrophobic faces tightly packed against each other. The β-sheet is composed of two long inner strands … expand

GO function:DNA binding (GO:0003677)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 240 MBD domains in 3 233 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MBD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MBD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the MBD domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the MBD domain.

ProteinDescriptionDisease / phenotype
MECP2_HUMANOMIM:312750 : Rett syndrome
OMIM:300005 : Rett syndrome
OMIM:312750 : Mental retardation, X-linked, with progressive spasticity
OMIM:300279 : Rett syndrome, preserved speech variant
OMIM:312750 : Mental retardation, X-linked, nonspecific

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MBD domain which could be assigned to a KEGG orthologous group, and not all proteins containing MBD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001739
PfamMBD