The BPI2 domain within your query sequence starts at position 415 and ends at position 617, and its E-value is 3.62e-78.

MGDNTNSQLAISANFLSSVLTMLQKQGAMDIDITDGMFEDLPPLTTSTLGALIPKVFQQYPESRPLTIRIQVPNPPTVTLQKDKALVKVFATSEVVVSQPNDVETTICLIDVDTDLLASFSVEGDKLMIDAKLDKTSLNLRTSNVGNFDVFILEMLVEKIFDLAFMPAMNAILGSGVPLPKILNIDFSNADIDVLEDLLVLST
BPI2

BPI2

BPI/LBP/CETP C-terminal domain
SMART ACC:SM000329
Description:Bactericidal permeability-increasing protein (BPI) / Lipopolysaccharide-binding protein (LBP) / Cholesteryl ester transfer protein (CETP) C-terminal domain
InterPro ACC:IPR001124
InterPro abstract:

This entry represents the C-terminal domain found in several lipid-binding serum glycoproteins. The N- and C-terminal domains share a similar two-layer α/β structure, but they show little sequence identity. Proteins containing this C-terminal domain include:

  • Bactericidal permeability-increasing protein (BPI)
  • Lipopolysaccharide-binding protein (LBP)
  • Cholesteryl … expand
GO function:lipid binding (GO:0008289)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 393 BPI2 domains in 3 367 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BPI2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BPI2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the BPI2 domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the BPI2 domain.

ProteinDescriptionDisease / phenotype
CETP_HUMANOMIM:118470 : CHOLESTERYL ESTER TRANSFER PROTEIN, PLASMA; CETP

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BPI2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing BPI2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamLBP_BPI_CETP
PROSITELBP_BPI_CETP
InterProIPR001124