The WH1 domain within your query sequence starts at position 1 and ends at position 107, and its E-value is 1.01e-38.

MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKVTELECVSS
WH1

WH1

WASP homology region 1
SMART ACC:SM000461
Description:Region of the Wiskott-Aldrich syndrome protein (WASp) that contains point mutations in the majority of patients with WAS. Unknown function. Ena-like WH1 domains bind polyproline-containing peptides, and that Homer contains a WH1 domain.
InterPro ACC:IPR000697
InterPro abstract:

The EVH1 (WH1, RanBP1-WASP) domain is found in multi-domain proteins implicated in a diverse range of signalling, nuclear transport and cytoskeletal events. This domain of around 115 amino acids is present in species ranging from yeast to mammals. Many EVH1-containing proteins associate with actin-based structures and play a role in cytoskeletal organisation. EVH1 domains recognise and bind the … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 280 WH1 domains in 4 278 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing WH1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing WH1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Protein-binding, polyproline-binding

Relevant references for this domain

Primary literature for the WH1 domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the WH1 domain.

ProteinDescriptionDisease / phenotype
WASP_HUMANOMIM:301000 : Wiskott-Aldrich syndrome ; Thrombocytopenia, X-linked
OMIM:313900 : Neutropenia, severe congenital, X-linked
OMIM:300299 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a WH1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing WH1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000697
PfamWH1