The DAX domain within your query sequence starts at position 1 and ends at position 82, and its E-value is 3.17e-54.

MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAE
DAX

DAX

Domain present in Dishevelled and axin
SMART ACC:SM000021
Description:Domain of unknown function.
InterPro ACC:IPR001158
InterPro abstract:

Proteins of the dishevelled family (Dsh and Dvl) play a key role in the transduction of the Wg/Wnt signal from the cell surface to the nucleus: in response to Wnt signal, they block the degradation of beta- catenin by interacting with the scaffolding protein axin. The N terminus of proteins of the dishevelled family and the C terminus of proteins of the axin family share a region of homology … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 668 DAX domains in 1 662 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DAX domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DAX domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the DAX domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DAX domain which could be assigned to a KEGG orthologous group, and not all proteins containing DAX domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001158