The XPGN domain within your query sequence starts at position 1 and ends at position 107, and its E-value is 2.5e-60.

MGIHGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEA
XPGN

XPGN

Xeroderma pigmentosum G N-region
SMART ACC:SM000485
Description:domain in nucleases
InterPro ACC:IPR006085
InterPro abstract:

Xeroderma pigmentosum (XP) [ PUBMED:8160271 ] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. People's skin cells with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven … expand

GO function:nuclease activity (GO:0004518)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 8 355 XPGN domains in 8 349 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing XPGN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing XPGN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the XPGN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a XPGN domain which could be assigned to a KEGG orthologous group, and not all proteins containing XPGN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITE XPG_2
InterProIPR006085
PfamXPG_N